SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56421256|ref|YP_148574.1| from Geobacillus kaustophilus HTA426

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56421256|ref|YP_148574.1|
Domain Number 1 Region: 127-273
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.93e-20
Family Extended AAA-ATPase domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56421256|ref|YP_148574.1|
Sequence length 313
Comment primosomal protein DnaI [Geobacillus kaustophilus HTA426]
Sequence
MERVNHLLQRLLGNQRFKQRYEQMKRYILEHPDVQPFLRAHERQLSADAVDRSLMKLYEF
IEQHGNCRQCPGLERCNNMLPGYHPNLVVNGGRIDVEYDRCPKKVQHDERKRQESLIQSM
FMPREILRASLSDVDLNDDGRIKAIRFAERFVAEYEPGKKMKGLYLHGSFGVGKTYLLAA
IANELAKRNVSSLIVYVPELFRELKHSLQDQTMNEKLDYIKKVPVLMLDDLGAEAMSSWV
RDDVFGPILQYRMFENLPTFFTSNFDMQQLAHHLTYSQRGEEEKVKAARIMERIRYLAYP
IEITGPNRREQNI
Download sequence
Identical sequences Q5KWD0
WP_011232195.1.2219 235909.GK2721 gi|56421256|ref|YP_148574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]