SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549478145|ref|YP_008611852.1| from Salmonella enterica subsp. enterica serovar Thompson str. RM6836

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549478145|ref|YP_008611852.1|
Domain Number 1 Region: 48-356,437-466
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.99e-63
Family Type II chitinase 0.00021
Further Details:      
 
Domain Number 2 Region: 368-435
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000058
Family Chitinase insertion domain 0.0041
Further Details:      
 
Domain Number 3 Region: 643-697
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000667
Family Carbohydrate binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549478145|ref|YP_008611852.1|
Sequence length 699
Comment chitinase [Salmonella enterica subsp. enterica serovar Thompson str. RM6836]
Sequence
MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYNKYKNSTTKPKVFGYYT
DWSQYDSRLQGNMSQPGRGYDLTKVSPTAYDKLIFGFVGITGFRKIDTEDRDVVAEAAAL
CGKVKYEPTFLDPWGDFQSYINLGFDVSGWDVDPKTVTQSNAKGLLGALRDMQAKAKAAG
HTLALSMSIGGWSMSNGFHETAASDSSRKIFAKGVVKLFKQFPMFSEVDIDWEYPNNEGA
GNPFGPEDGANYALLIAELRKQLDSAGLSNVKISIAASAVTTIFDYAKVKDLMAAGLYGI
NLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDHLLAEGFSADRINIGYAGYTRNA
RQVEIESLSPLKGSYNPGSGPTTGSFESGTSEWYDVIYSYLDLENQKGRNGFNVYTDQVA
DADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGGVFTWTIDQDNGVLVNAVREGLGYE
IESEVIDMEPFYFEGINVEKDEEQSDSDDAQKVNHAPKAAIELLVVGGSTVQLSGAGSSD
EDNDELSFSWGVPSQITVADKTAEIIEVVVPEVSEKTAFQFTLFVRDCYNEPSSQQRFVL
TAVPALSQVQPEPEEEEEIIVPVPDEEEDTTPAEDDTPADDKTSPYAQWDASTVYGANWG
SFEIVSWKGHNYQVKWWSMGNQPDLNCGVGGAWTDLGAY
Download sequence
Identical sequences A0A2I6TQG5 M7RYY2
gi|198242422|ref|YP_002213973.1| 439851.SeD_A0019 CP001144|CDS_17869-19968 gi|549478145|ref|YP_008611852.1| WP_000235796.1.100017 WP_000235796.1.101724 WP_000235796.1.101927 WP_000235796.1.1239 WP_000235796.1.12456 WP_000235796.1.15214 WP_000235796.1.1601 WP_000235796.1.17096 WP_000235796.1.1990 WP_000235796.1.20767 WP_000235796.1.21616 WP_000235796.1.22590 WP_000235796.1.22845 WP_000235796.1.2376 WP_000235796.1.24392 WP_000235796.1.24476 WP_000235796.1.24803 WP_000235796.1.25421 WP_000235796.1.2568 WP_000235796.1.25709 WP_000235796.1.26532 WP_000235796.1.26587 WP_000235796.1.27342 WP_000235796.1.27513 WP_000235796.1.27616 WP_000235796.1.2825 WP_000235796.1.29274 WP_000235796.1.29923 WP_000235796.1.3067 WP_000235796.1.31845 WP_000235796.1.31983 WP_000235796.1.32902 WP_000235796.1.33865 WP_000235796.1.34 WP_000235796.1.34684 WP_000235796.1.35332 WP_000235796.1.35619 WP_000235796.1.3572 WP_000235796.1.36978 WP_000235796.1.3726 WP_000235796.1.38881 WP_000235796.1.38895 WP_000235796.1.39414 WP_000235796.1.39614 WP_000235796.1.40158 WP_000235796.1.40284 WP_000235796.1.41345 WP_000235796.1.4141 WP_000235796.1.41434 WP_000235796.1.44397 WP_000235796.1.4592 WP_000235796.1.47817 WP_000235796.1.48268 WP_000235796.1.50905 WP_000235796.1.54469 WP_000235796.1.55853 WP_000235796.1.56368 WP_000235796.1.56950 WP_000235796.1.58157 WP_000235796.1.58749 WP_000235796.1.59097 WP_000235796.1.59335 WP_000235796.1.59512 WP_000235796.1.60608 WP_000235796.1.6108 WP_000235796.1.61509 WP_000235796.1.62222 WP_000235796.1.62245 WP_000235796.1.64121 WP_000235796.1.66122 WP_000235796.1.66289 WP_000235796.1.66937 WP_000235796.1.68690 WP_000235796.1.68958 WP_000235796.1.69346 WP_000235796.1.70303 WP_000235796.1.70929 WP_000235796.1.70977 WP_000235796.1.71600 WP_000235796.1.72107 WP_000235796.1.72182 WP_000235796.1.72351 WP_000235796.1.72470 WP_000235796.1.72625 WP_000235796.1.73764 WP_000235796.1.74639 WP_000235796.1.75180 WP_000235796.1.77067 WP_000235796.1.77436 WP_000235796.1.77754 WP_000235796.1.79757 WP_000235796.1.79914 WP_000235796.1.80479 WP_000235796.1.80609 WP_000235796.1.81455 WP_000235796.1.83516 WP_000235796.1.8425 WP_000235796.1.85742 WP_000235796.1.86159 WP_000235796.1.86240 WP_000235796.1.86389 WP_000235796.1.86807 WP_000235796.1.86860 WP_000235796.1.87760 WP_000235796.1.87936 WP_000235796.1.88698 WP_000235796.1.88982 WP_000235796.1.89632 WP_000235796.1.92754 WP_000235796.1.93410 WP_000235796.1.93691 WP_000235796.1.94039 WP_000235796.1.94982 WP_000235796.1.94983 WP_000235796.1.95289 WP_000235796.1.95558 WP_000235796.1.96490 WP_000235796.1.96584 WP_000235796.1.97480 WP_000235796.1.99577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]