SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549480596|ref|YP_008614867.1| from Salmonella enterica subsp. enterica serovar Thompson str. RM6836

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549480596|ref|YP_008614867.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.27e-110
Family FMN-linked oxidoreductases 0.0000000000445
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.94e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000929
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.02e-28
Family C-terminal domain of adrenodoxin reductase-like 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549480596|ref|YP_008614867.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Salmonella enterica subsp. enterica serovar Thompson str. RM6836]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAEGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYTSRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDVTGVTLKLNQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
VLTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRPEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A2I6TGK6 A0A2J5X098
WP_017465428.1.100584 WP_017465428.1.100750 WP_017465428.1.101724 WP_017465428.1.11304 WP_017465428.1.15612 WP_017465428.1.1601 WP_017465428.1.1990 WP_017465428.1.20789 WP_017465428.1.22845 WP_017465428.1.23309 WP_017465428.1.23670 WP_017465428.1.2376 WP_017465428.1.24392 WP_017465428.1.24444 WP_017465428.1.25072 WP_017465428.1.27342 WP_017465428.1.27513 WP_017465428.1.27616 WP_017465428.1.2825 WP_017465428.1.29923 WP_017465428.1.30437 WP_017465428.1.31845 WP_017465428.1.32902 WP_017465428.1.33160 WP_017465428.1.36978 WP_017465428.1.37190 WP_017465428.1.38881 WP_017465428.1.38895 WP_017465428.1.41345 WP_017465428.1.46203 WP_017465428.1.47817 WP_017465428.1.50285 WP_017465428.1.5058 WP_017465428.1.52748 WP_017465428.1.5316 WP_017465428.1.55477 WP_017465428.1.55496 WP_017465428.1.55718 WP_017465428.1.56368 WP_017465428.1.58157 WP_017465428.1.59097 WP_017465428.1.59512 WP_017465428.1.60608 WP_017465428.1.6108 WP_017465428.1.61497 WP_017465428.1.61509 WP_017465428.1.62222 WP_017465428.1.63781 WP_017465428.1.68690 WP_017465428.1.68958 WP_017465428.1.6907 WP_017465428.1.69346 WP_017465428.1.72107 WP_017465428.1.72220 WP_017465428.1.72351 WP_017465428.1.72968 WP_017465428.1.73596 WP_017465428.1.73901 WP_017465428.1.74639 WP_017465428.1.75180 WP_017465428.1.77184 WP_017465428.1.77436 WP_017465428.1.79370 WP_017465428.1.79914 WP_017465428.1.80443 WP_017465428.1.80479 WP_017465428.1.80542 WP_017465428.1.81795 WP_017465428.1.83407 WP_017465428.1.83516 WP_017465428.1.84001 WP_017465428.1.84100 WP_017465428.1.85742 WP_017465428.1.86389 WP_017465428.1.86807 WP_017465428.1.86860 WP_017465428.1.88698 WP_017465428.1.89632 WP_017465428.1.93061 WP_017465428.1.93691 WP_017465428.1.94039 WP_017465428.1.94412 WP_017465428.1.94982 WP_017465428.1.94987 WP_017465428.1.95744 WP_017465428.1.97480 WP_017465428.1.98402 WP_017465428.1.99824 gi|549480596|ref|YP_008614867.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]