SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|CAGL0M05643g from Candida glabrata CBS138

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|CAGL0M05643g
Domain Number 1 Region: 50-164
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.1e-35
Family Frataxin-like 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|CAGL0M05643g
Sequence length 176
Comment similar to uniprot|Q07540 Saccharomyces cerevisiae YDL120w YFH1 regulates mitochondrial iron accumulation [Candida glabrata] Complete CDS. CAGL0M05643g
Sequence
MIRNILRRSAARVRIPVTSATCASRLVMSIRLATSTRYYSNGNEGGPAMTNGVQIPKEVL
ELPLQQYHQHSESFLEGLFDNLEELSENYPQHIPEVEYSHGVMSLTVAGVGTYVINKQPP
NKQIWLSSPNSGPNRFDLYKGEWISLRNNETLLSVLDKELHDALPNDAEFKVESDQ
Download sequence
Identical sequences Q6FJK3
XP_449591.1.27851 gnl|GLV|CAGL0M05643g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]