SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339492304|ref|YP_004712597.1| from Pseudomonas stutzeri ATCC 17588 = LMG 11199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339492304|ref|YP_004712597.1|
Domain Number 1 Region: 4-206
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.88e-52
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339492304|ref|YP_004712597.1|
Sequence length 207
Comment nitrate-inducible formate dehydrogenase subunit gamma [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
Sequence
MNNNEIERYNPSQRTNHWIVAILFVLAALSGLALFHPALFGLSGLFGGGTWTRILHPFIG
VAMFVFFLWLAIRFAGHNRIEARDRQWLRQINDVVHNREEKLPEVGRYNAGQKVLFWVLI
LSMLVLLLSGIVIWREYFSSFFGIVSLRWASLLHAIAAFVLIVSIIVHIYAAIWIKGSMG
SMLYGTVSRAWARKHHPAWYREINQRK
Download sequence
Identical sequences A0A0T8L7U3 F8H571
WP_013981363.1.82288 WP_013981363.1.85630 gi|339492304|ref|YP_004712597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]