SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339494122|ref|YP_004714415.1| from Pseudomonas stutzeri ATCC 17588 = LMG 11199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339494122|ref|YP_004714415.1|
Domain Number 1 Region: 10-213
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4e-53
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339494122|ref|YP_004714415.1|
Sequence length 234
Comment nitrate-inducible formate dehydrogenase subunit gamma [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
Sequence
MSHSNVRKGILRYGPWARANHWIVAICFVLLTLSGLALFYPAFFGLTALFGGPEPTRIVH
PYIGVFMTLFFLIQAVRFFRANLFRRYDVQWARQIGDVLSNRDERLPPVGQNNAGQKLVY
WVFLATVPVLLVTGVVLWRPWVASEMPIWALRWAALIHAVTAFVAILTLIIHVYSAIWVK
GSIRAMTQGRVSPAWARHHHKLWYDEVMAGEKRGDETALPHREPGDAAASRPRT
Download sequence
Identical sequences F8HAS6
WP_013982829.1.11668 WP_013982829.1.55002 WP_013982829.1.85630 WP_013982829.1.88125 WP_013982829.1.98540 gi|339494122|ref|YP_004714415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]