SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339495918|ref|YP_004716211.1| from Pseudomonas stutzeri ATCC 17588 = LMG 11199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339495918|ref|YP_004716211.1|
Domain Number 1 Region: 12-205
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.5e-28
Family Clp protease, ClpP subunit 0.022
Further Details:      
 
Domain Number 2 Region: 378-444
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000116
Family NfeD domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339495918|ref|YP_004716211.1|
Sequence length 458
Comment hypothetical protein PSTAB_3841 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
Sequence
MPRHPARWLLALLLALAVQSASAADPVTLLRVDGAIGPASADYILRGLQHARDEGAQLVV
LELDTPGGLDTSMRAIIKAILASPIPVATYVTPSGARAASAGTYMLYASHVAAMAPGTNL
GAATPVQIGGMPGAPPEQPKGEREDDAKASGDALARKQVNDAAAYIRGLAQLRERNAEWA
EQAVREAVSLSASEALKLKVIDYLARDVADLLRQLDGKTLATIEGEVRLQTADARLIEHA
PDWRVRLLAVITNPSVALILMMIGIYGLILEFSNPGMGAGGVLGGICLILALYALQLLPV
NYAGVALILLGIAFMVAEAFLPSFGVLGIGGVAAFVAGAVILIDTEVPGFGIPLSLIVPL
GFASALLVFAIVAMALKARRQRLVGGDAELIGSLAPVTGISAQDPHSGWVHLQGENWQVR
SATPLQVGQQVRVVAREGLQLNVAAQPSSNREELNHGL
Download sequence
Identical sequences A0A1G3DAN7 F8H3Y7
WP_013984263.1.54801 WP_013984263.1.85630 WP_013984263.1.9384 gi|339495918|ref|YP_004716211.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]