SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|308178984|ref|YP_003918390.1| from Arthrobacter arilaitensis Re117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308178984|ref|YP_003918390.1|
Domain Number 1 Region: 94-289
Classification Level Classification E-value
Superfamily Formyltransferase 2.49e-62
Family Formyltransferase 0.00015
Further Details:      
 
Domain Number 2 Region: 5-93
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000000108
Family Glycine cleavage system transcriptional repressor 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|308178984|ref|YP_003918390.1|
Sequence length 290
Comment formyltetrahydrofolate deformylase [Arthrobacter arilaitensis Re117]
Sequence
MTEPNNKYVLTLTCAERPGIVHAVTGLLLKHHGDIRELKQHDDQRSGTLFMRIEFDVAEA
RDAPAEIAELESSLGKLADEHQATWGLRPSGKKKRVVVMVSKFGHCLHDLLFRARMGELP
VEIAAVVSNHPDHRQQVEWNGIPFFHVPVTAQSKPEAEAKLMDLVDRFEVDLVVLARYMQ
VLSDDLTRKLTGRAINIHHSFLPSFKGAKPYHQAFERGVKTVGATAHYVNSELDEGPIIT
QRVQEVDHSYEPEHLVAAGRDTECKALSDAVRWHCEDRVFLSGSRTVVLR
Download sequence
Identical sequences E1W0L6
WP_013350518.1.27002 gi|308178984|ref|YP_003918390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]