SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|308175891|ref|YP_003915297.1| from Arthrobacter arilaitensis Re117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308175891|ref|YP_003915297.1|
Domain Number 1 Region: 122-265
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 1.57e-44
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.0000852
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 2.33e-31
Family DHN aldolase/epimerase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|308175891|ref|YP_003915297.1|
Sequence length 277
Comment bifunctional dihydroneopterin aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [Arthrobacter arilaitensis Re117]
Sequence
MDRISVCGISATGYHGVFDHEKRDGQKFIIDVVLHVDISRAAASDNVLDTVHYGEVSELV
VQQIQSGPWDLIEKLGSEIAEAILAAYPSVYTIDVVVHKPQAPIPVPFTDVTISLTRHQK
QHTAIIALGANLGDPQATLAAAVQELGADVELLKVSPLAITKPVGGPPEQPDYTNQVVQV
RTGLSPHELLDLCQSIEAKHHRTREVRWEARTLDLDLIAYDHLRMDDERLTLPHPRAAIR
GFVLAPWSWMDPDAVLDGQLVSRLAAEAADTKDIIRL
Download sequence
Identical sequences E1VRS2
gi|308175891|ref|YP_003915297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]