SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|308178473|ref|YP_003917879.1| from Arthrobacter arilaitensis Re117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308178473|ref|YP_003917879.1|
Domain Number 1 Region: 295-517,563-775
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.08e-71
Family Ornithine decarboxylase major domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|308178473|ref|YP_003917879.1|
Sequence length 910
Comment amino acid decarboxylase [Arthrobacter arilaitensis Re117]
Sequence
MSKRLTFGTNQGTATPESAWRKRKDAWEHLGYVLSEISSEYQEENRRQEHELEAGRLLGL
LAAIEPYWANPGIEYFNEVSRLMSGGQYEDAMKLVYQANQTFRTLTQYVDLEGHEGAETD
SLESGAASVSKGKLYIPMVEILLVDNGPTEEIERFKEEIVEQRQHTDPFHYNFVVVPSVE
DALAAILINPSIQAVVLTARFDTCTRRRLSSTLKNFIARRMNGFFGSTKQIQGLLDLENI
LDDLRPEIPVYLIAGVALESIAHEITGRFRRIFSRNDRMDLHLSIVSEVLERYQTPFFNA
LQKYAKRPGGVFHAMPISRAGSVQNSPWARDLVDFYGKNLLLAETSATSGGLDSLLDPQS
SIKKAHELAARAFGSHRTYFVTNGTSTANKIVHQSILAPGDIVLVDRNCHKSHHYSLVLA
GANVSYLEAYPLNEHSMYGAVPLEEIKGRLLQLRREGLLHKVKMLTLTNCTFDGIIYDPR
RVMEECLAIKPDLVFLWDEAWFAFAGFHPVYRQRTAMTVATGLEEELENEEYAQRYAAQK
AALPEPGTSNQPENDQAWLETRLLPDPEKVRLRVYSTQSTHKTLTSLRQGSMIHIYDQDF
ALRNLNAFREAYMTHTSTSPNYQILASLDIGRRQAELEGYALVQRQVDLAQSVCRAMARN
ELLGKYFKILNSDELIASKYRESTSANPVRDGLAAWDEAWQNDEFVVDPSRLTLDISRTG
VDGDTFKHEYLMDGHSIQVNKTSRTSVLLMTNIGTTRSAVAHLIEVLVKIAEELERKRRL
DGRVLAMGKKSAKELIPLPDFSSFAPEFSGGGGSGDMRAAYYLTYQDPATHFLSSAQIRS
ELMEGQRIVSAVFVTPYPPGFPVLVPGQLVTLGILDYMDRLDTREIHGYHQDLGYQVFTH
EAMAQLQPRK
Download sequence
Identical sequences E1VZ55
WP_013350023.1.27002 gi|308178473|ref|YP_003917879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]