SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for sp|Q74Z05|DCP1_ASHGO from Ashbya gossypii ATCC 10895

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  sp|Q74Z05|DCP1_ASHGO
Domain Number 1 Region: 19-189
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-62
Family Dcp1 0.000000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) sp|Q74Z05|DCP1_ASHGO
Sequence length 193
Comment mRNA-decapping enzyme subunit 1 OS=Ashbya gossypii GN=DCP1
Sequence
MTTARDNSATTLELYRKTLNFNVIGRYDPKIKQLLFHTPHATVYKWEAGENKWNKLEYQG
VLAIYLRDVREQAELPVPHQEASAGAEGRCGEVLSGRDIYNYALIVLNRINPENFSIAIA
PNSVVNKRRLFSPEENVQQPLEPMDVEVKDELVIIKNLRKEVYGIWIHTPTDRQNIYDLL
KYLLENEPKDSFA
Download sequence
Identical sequences Q74Z05
sp|Q74Z05|DCP1_ASHGO NP_987068.1.49492 33169.AGOS_AGR402C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]