SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|Q74Z19|Q74Z19_ASHGO from Ashbya gossypii ATCC 10895

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|Q74Z19|Q74Z19_ASHGO
Domain Number 1 Region: 7-113
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 8.2e-38
Family Frataxin-like 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|Q74Z19|Q74Z19_ASHGO
Sequence length 119
Comment AGR387Cp OS=Ashbya gossypii GN=AGR387C
Sequence
MRAPPELAQLTPQAYHKQADEFLNDLLDRLEALGDERPDIIADSEYSQGVLTLSVPALGT
YVINKQPPNKQIWLSSPVSGPNRYDLIDGEWVSLRDGSRLMAVLSRELGRALDNPDYAL
Download sequence
Identical sequences Q74Z19
NP_987053.2.49492 tr|Q74Z19|Q74Z19_ASHGO 33169.AGOS_AGR387C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]