SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|Q758S4|Q758S4_ASHGO from Ashbya gossypii ATCC 10895

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|Q758S4|Q758S4_ASHGO
Domain Number 1 Region: 238-513,549-600
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.95e-87
Family IF2B-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|Q758S4|Q758S4_ASHGO
Sequence length 604
Comment AEL322Wp OS=Ashbya gossypii GN=AEL322W
Sequence
MSTDADVASTQRENAADANPRESSAEREATAPSVSEEHKLSNKELKELKKQEKAAKRAAK
KQASGITIEQQQQQAQLKKEKKQHQREQQMSGAKKGRSGNPGIPIADKKSTLFGHLETTE
ERRASLLAVISAISSNGASKITATGLMIPTVASAMASSAAPALAAGHTGAAGPANPEVSA
QAMASMSLDEESSFVPGLLSVLPIAIEEDFKNPQLMSSVKELVANKDMLHPAVVLLTSEF
GAYKIVGSIPRCLAMLEVFQIVIREYKTPEGTTLSRNLTHYLSHQIDFLKKARPLSVTMG
NAIRWLKQEISLIDPATSDVQAKELLCEKIAQFAREKVELADQLILENASQHIDNDSTIL
TYGCSKVLTDLFIYNAVDLGKNFNIIIVDSRPLFEGRKMAEVLRKRGLNITYVMITSLAT
IFSMDIDYVFLGAHSILSNGFLYSRVGTAMLAMSAKRRNIPVIVACESLKFSQRVQLDSV
TFNELADPNILVDINTDNPVKRRSNKGFLLQRFVKESQALMKQKDEQDTKQNKNGKAKFI
TDDNKKSDSDKAILADWQDLPSLNIYNIMYDLTPPEYIKKVVTEFGALPPSSVPVILREY
KGSA
Download sequence
Identical sequences Q758S4
NP_984538.1.49492 33169.AGOS_AEL322W tr|Q758S4|Q758S4_ASHGO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]