SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392419395|ref|YP_006455999.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392419395|ref|YP_006455999.1|
Domain Number 1 Region: 4-180
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 7.06e-41
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392419395|ref|YP_006455999.1|
Sequence length 184
Comment cytochrome b561 [Pseudomonas stutzeri CCUG 29243]
Sequence
MHWRNTSTNYGLTSIALHWLVAIAVFGLFGLGFWMVGLNYYSSWYRTAPDLHKSIGIVLF
MVMLLRVLWRFVSPAPAPLASQGRLTRIAARLGHSLLYLGLFLVMISGYLISTADGRPIS
VFGLFEVPALITSIPDQADSAGLVHEYAAWALVIFAVVHALAALKHHFIDRDATLKRMLG
RAAG
Download sequence
Identical sequences I4CNB9
WP_014818760.1.18623 gi|392419395|ref|YP_006455999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]