SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392419407|ref|YP_006456011.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392419407|ref|YP_006456011.1|
Domain Number 1 Region: 320-441
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 6.94e-24
Family Flavohemoglobin, C-terminal domain 0.076
Further Details:      
 
Domain Number 2 Region: 233-316
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.23e-17
Family Ferredoxin reductase FAD-binding domain-like 0.0078
Further Details:      
 
Weak hits

Sequence:  gi|392419407|ref|YP_006456011.1|
Domain Number - Region: 29-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0581
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392419407|ref|YP_006456011.1|
Sequence length 443
Comment putative flavocytochrome [Pseudomonas stutzeri CCUG 29243]
Sequence
MRQIKLTYVALFVGLTLLWLLVDDFIMARYQFWPLRKVLVHYSGVLGIVAMSVAMVLAAR
PRRFERFFDGLDKTYRLHKWLGISALVIAIFHWGWGQIPKWLVGFGWLEKPARRAGEGQM
HEGIFALLQRFRGLAETIGEWAFYAAAILIVLALVKSFPYRWFFKTHRWLALVYLALVVH
SVVLTPPDYWTSPLGLVLAVMMASGSVAACISLLRRIGRKHQVVGRIDGLTHHRDNRVLR
VDIKLDGPWPGHKAGQFAFVTFDDKEGPHPFSLSSAWCNDGRLAFSIKGLGDYTRTLPDT
LKVGDAVKVEGPYGCFDFHSRKPRQIWVAGGIGIAPFIGRLQALAASGKGDNVDLFYCTS
APDQSFIERIRELAARARVRLHVLVASEGGRLTPERLRQLAPQWQDSDVWFCGPAGFGQD
LSRDLQRHGLPPRDFHQELFNMR
Download sequence
Identical sequences I4CND1
gi|392419407|ref|YP_006456011.1| WP_014818771.1.18623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]