SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392420412|ref|YP_006457016.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392420412|ref|YP_006457016.1|
Domain Number 1 Region: 195-325
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 9.82e-35
Family Aromatic dioxygenase reductase-like 0.0063
Further Details:      
 
Domain Number 2 Region: 98-191
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 9.5e-26
Family Ferredoxin reductase FAD-binding domain-like 0.0029
Further Details:      
 
Domain Number 3 Region: 4-92
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.04e-21
Family 2Fe-2S ferredoxin-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392420412|ref|YP_006457016.1|
Sequence length 328
Comment naphthalene 1,2-dioxygenase reductase component [Pseudomonas stutzeri CCUG 29243]
Sequence
MELLVLPNNRRLPFDSGANLLEVLREHRVGISYSCMSGRCGTCRCRVIDGSVISSAAKSG
DSNRIEEHYVLACQSVLTSNCAIEIIDSDDIVTHPARIIKGMVVAVESPTHDIRRIRIRL
AKPFEFSPGQYATLQFSPEHVRPYSMAGLPDDQEMEFHIRKVPGGRVTEYIFEHVREGTS
IKLSGPLGTAYLRQAHTGPMLCVGGGTGLAPVLSIVRGALKSGMTNPIHLYFGVRSQQDL
YDADRLNQLAAIHPQLTVHTVIATGPINEGQRAGLITDLIEKDIPSLAGWRAYLCGAPAM
VDALCTVAKVLGISPEHIYADAFYPSGV
Download sequence
Identical sequences I4CR86 Q9ZI75
gi|392420412|ref|YP_006457016.1| WP_014819639.1.18623 WP_014819639.1.50587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]