SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392420697|ref|YP_006457301.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392420697|ref|YP_006457301.1|
Domain Number 1 Region: 102-256
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.1e-43
Family Reductases 0.000000266
Further Details:      
 
Domain Number 2 Region: 6-99
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.65e-25
Family Ferredoxin reductase FAD-binding domain-like 0.0000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392420697|ref|YP_006457301.1|
Sequence length 258
Comment oxidoreductase FAD/NAD(P)-binding subunit [Pseudomonas stutzeri CCUG 29243]
Sequence
MSNLNVERVLSVHHWNDTLFSFKTTRNAGLRFENGQFVMIGLEVEGRPLMRAYSIASPNY
EEYLEFFSIKVQNGPLTSRLQHLQEGDQIMVSRKPTGTLVLDDLLPGKHLYLLSTGTGLA
PFMSVIQDPETYERFEKVVLVHGVRYANEVAYREFITEHLPQNEFFGEAVKEKLIYYPTV
TREPFENQGRLTELMRSGKLFSDIGLPPINPQDDRAMICGSPSMLDETSQVLDSFGLSVS
PRMGDPGHYLIERAFVEK
Download sequence
Identical sequences A0A098FM15 A0A0D7E2I4 A0A0F2QAJ9 A0A0I9SIQ9 A0A1C2K4H5 A0A1G3D5P2 A0A2D6J4E5 I4CS21
gi|392420697|ref|YP_006457301.1| WP_014819886.1.18623 WP_014819886.1.28465 WP_014819886.1.29661 WP_014819886.1.59315 WP_014819886.1.82794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]