SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392420896|ref|YP_006457500.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392420896|ref|YP_006457500.1|
Domain Number 1 Region: 204-333
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.49e-34
Family Aromatic dioxygenase reductase-like 0.0000659
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.01e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00042
Further Details:      
 
Domain Number 3 Region: 76-204
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.3e-23
Family Ferredoxin reductase FAD-binding domain-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392420896|ref|YP_006457500.1|
Sequence length 336
Comment toluate 1.2-dioxygenase reductase subunit [Pseudomonas stutzeri CCUG 29243]
Sequence
MTHKIALNFEDGVTRFIDANLGETVADAAYRQGINVPLDCRDGACGACKCFAESGRYDLG
EEYIEDALSEAEAEQGYVLTCQMRAESDCVIRVPAASDICKTQQANYQAAISNVRQLSES
TIALSIKGVSLNQLAFLPGQYVNLQVPGSDQTRAYSFSSLQKDGEVSFLIRNVPGGLMSS
FLTNLAKAGDSVNLAGPLGAFYLREIKRPLLLLAGGTGLAPFTAMLEKIAEQGSEHPLHL
IYGVTHDHDLVEMEKLEEFAARIPNFTYSACVASPDSAYPQKGYVTQHIEPRHLNDGEVD
IYLCGPPPMVEAVSGFIREQGLEPANFYYEKFAASA
Download sequence
Identical sequences I4CSM0
gi|392420896|ref|YP_006457500.1| WP_014820055.1.18623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]