SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392421064|ref|YP_006457668.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392421064|ref|YP_006457668.1|
Domain Number 1 Region: 119-288
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.24e-27
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392421064|ref|YP_006457668.1|
Sequence length 288
Comment cytochrome b561 [Pseudomonas stutzeri CCUG 29243]
Sequence
MKASPELHYPCSSAATVATANPSRLINRLCKHWAHKFPVRHDEQGGEITLGIGECRLRAA
EAGLEVRLHAANPAQLRQLQQVVAEHLLRMASGEALVFAWHAGAGAGAAPAEERNRLHDT
RERYGRISRGFHWLMAGLIVWQFLKLGDRIDEGEHWIGQTLVPWHISIGALLLVLVVLRV
VWASAQRGRRPLPDPATAVLVKGGHLALYACMLLLPVSGILFMLGNGYGLEVFGVQLAAK
GPEIAWAASLGSIHSPLAWLTVLLVVGHAGIALLHHLIRRDGVLQRML
Download sequence
Identical sequences A0A1C2K3P8 I4CT38
WP_014820207.1.18623 WP_014820207.1.59315 gi|392421064|ref|YP_006457668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]