SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392421982|ref|YP_006458586.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392421982|ref|YP_006458586.1|
Domain Number 1 Region: 147-264
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000034
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 
Weak hits

Sequence:  gi|392421982|ref|YP_006458586.1|
Domain Number - Region: 65-105
Classification Level Classification E-value
Superfamily FlgN-like 0.0732
Family FlgN-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392421982|ref|YP_006458586.1|
Sequence length 270
Comment tol-pal system protein YbgF [Pseudomonas stutzeri CCUG 29243]
Sequence
MRKYRHALTLTVLALPLMAVAQVPVVDYEEGAASGNSGYSTAAPGGDGAYAGGGATAPSS
AQGMLFMQLQQMQEEIAQLRGMLEEQQNQIQRLQQEGLERYQDLDRRLSSGSAAGNQPAP
SSNTAASAGSSAPAAASQGQSQSASGDPAKEKLYYDAAFDLIKAKDFDKASQAFAAFLRK
YPDSQYAGNAQYWLGEVNLAKGDLQGAGQAFARVSQAYPQHNKVPDSLYKLADVEIRLGN
RDKAQGILREVIAQYPNTSAAQLAQRQLNR
Download sequence
Identical sequences I4CVQ6
WP_014821033.1.18623 gi|392421982|ref|YP_006458586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]