SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392422245|ref|YP_006458849.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392422245|ref|YP_006458849.1|
Domain Number 1 Region: 4-85
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.7e-22
Family 2Fe-2S ferredoxin-related 0.023
Further Details:      
 
Domain Number 2 Region: 189-307
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.57e-21
Family Reductases 0.088
Further Details:      
 
Domain Number 3 Region: 93-182
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.4e-17
Family Ferredoxin reductase FAD-binding domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392422245|ref|YP_006458849.1|
Sequence length 313
Comment hypothetical protein A458_16005 [Pseudomonas stutzeri CCUG 29243]
Sequence
MPELHCAGKRWSVAPATNLLDALIAAGLPVPYSCRAGSCHACLVRCVDGAPRDLQPDLLR
PEQHAAGWRLACQCLVEEEIGVEVFDPRRDGQPAQVQSAEWLSGSVLRLRLLPERPLRYR
AGQHLLLWTGAGIARPYSLASVPGDDPWLEFHLDCSRPGAFCDAARQLRAGDTLRLGDLH
GGALHYEPEWSERSLLLLASGTGLAPLFSLLRESLRQGHAGTIRLVHFCRDEHYLRGPLQ
ELADRHENLELQWVDAQQRDSMLSTLRPTSRRDIALLCGGSAFVDACARRLFLAGLPRGQ
IFSDAFVSATQPQ
Download sequence
Identical sequences I4CWG9
WP_014821280.1.18623 gi|392422245|ref|YP_006458849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]