SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392422328|ref|YP_006458932.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392422328|ref|YP_006458932.1|
Domain Number 1 Region: 13-276
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.57e-95
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000339
Further Details:      
 
Domain Number 2 Region: 281-397
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 2.01e-32
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392422328|ref|YP_006458932.1|
Sequence length 403
Comment ubiquinol--cytochrome c reductase, cytochrome b [Pseudomonas stutzeri CCUG 29243]
Sequence
MSKFMEWVDARFPATKMWEDHLSKYYAPKNFNVLYFFGSLALLVLVNQILTGIWLTMSFE
PSAEGAFASVEYIMRDVEYGWIIRYLHSTGASAFFVVVYLHMFRGILYGSYQKPRELVWI
FGMMIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGGDLTQWIRGDYLISGIT
LNRFFALHVIALPIVILGLVVLHILALHEVGSNNPMGVDIKKTKDENGVPLDGIPFHPYY
TVKDIVGVVVFLFVFCAVVFFFPEMGGYFLEKPNFEVANAFKTPAHIAPVWYFTPFYAIL
RAVPDKLLGVIAMGAAIAVLFVLPWLDRSPVKSMKYKGWMSKVTLLAFCVSFIILGVLGV
LAPTPERTLLARICTAIYFGYFILMPFYTKLEKTKVVPQRVAG
Download sequence
Identical sequences A0A0D7E3F1 A0A1C2JZJ3 I4CWQ2 M2UZ41 V4QJ53
gi|392422328|ref|YP_006458932.1| WP_003302794.1.18623 WP_003302794.1.35692 WP_003302794.1.59315 WP_003302794.1.86065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]