SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392422398|ref|YP_006459002.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392422398|ref|YP_006459002.1|
Domain Number 1 Region: 67-205
Classification Level Classification E-value
Superfamily Flavoproteins 1.17e-39
Family Cytochrome p450 reductase N-terminal domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 378-519
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.02e-36
Family NADPH-cytochrome p450 reductase-like 0.00048
Further Details:      
 
Domain Number 3 Region: 217-377
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.95e-21
Family Ferredoxin reductase FAD-binding domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392422398|ref|YP_006459002.1|
Sequence length 519
Comment sulfite reductase (NADPH) flavoprotein alpha-component [Pseudomonas stutzeri CCUG 29243]
Sequence
MPRPFQSVRRLSPLLGCLAVAALLLWWQPPRAISAAVVVLVYLAMSLYCWRRQLPRKAAS
TDATSALVVTYASQGGQARLYAERSAEQLREAGLNVQLLPLNALEPSRLPARRILFVVST
YGEGEAPDDGARFERRLSTANLQLQDLEYAVLAFGDRQYRHFCAFGQRLDERMRQCGATP
LFDRLEADRADPGVLRHWQQQLAQLSGNSDFSDWLPAPYRQWQLTERRCLNPGSAGGPVQ
HLTLVPVDDQQRWRAGDIVEVGPQHELARMERLLQQLDHDPQQRVDGQRLASQLAGLRLP
DLDVLRTLDLPALLALPPLPHREYSIASIPSDGAVQLVVREARHPDGTLGLGSGWLCRHA
AIGERIALRIRSNPGFHGPSVDTPLILIGNGTGIAGLRAHLRERAAAPQGSRSWLLFGER
NAAHDFFFRDELQHWLDSGLLERLDLAFSRDQPEKRYVQQVLRDAADDLRRWIDQGAAIY
VCGSLEGMGQEVQQILLGLLGQARLEQLSEQGRYRRDLY
Download sequence
Identical sequences I4CWX2
gi|392422398|ref|YP_006459002.1| WP_014821413.1.18623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]