SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392422464|ref|YP_006459068.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392422464|ref|YP_006459068.1|
Domain Number 1 Region: 108-258
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.1e-34
Family Reductases 0.0002
Further Details:      
 
Domain Number 2 Region: 7-104
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.4e-21
Family Ferredoxin reductase FAD-binding domain-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392422464|ref|YP_006459068.1|
Sequence length 258
Comment oxidoreductase [Pseudomonas stutzeri CCUG 29243]
Sequence
MTASEEKFTRQRLLEVQTLTPNLFTLRTSRDPGFRFTAGQFARLGVRKPSGCIVWRAYSM
VSAPHDEFLDFFSIVVPDGEFTSELSRLAVGDELLVDKQAFGFLTLDRFPDGRDLWLLAT
GTGIAPFLSILQDFEAWQRFERIILVYSVREARELAYQQLIAELPQRDYLDGLGSKLLYL
PVVTREQIPGALHGRITTLIENGELERAADLQLTPEHSRIMLCGNPQMIEDTRAVLKARD
LNLAMTRRPGQVAVENYW
Download sequence
Identical sequences A0A1C2K8C8 I4CX38
WP_014821468.1.18623 WP_014821468.1.28465 gi|392422464|ref|YP_006459068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]