SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392422476|ref|YP_006459080.1| from Pseudomonas stutzeri CCUG 29243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392422476|ref|YP_006459080.1|
Domain Number 1 Region: 303-426
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.36e-27
Family Flavohemoglobin, C-terminal domain 0.029
Further Details:      
 
Domain Number 2 Region: 417-522
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.51e-27
Family 2Fe-2S ferredoxin-related 0.011
Further Details:      
 
Domain Number 3 Region: 198-298
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.23e-24
Family Ferredoxin reductase FAD-binding domain-like 0.0034
Further Details:      
 
Domain Number 4 Region: 8-167
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.00000000000000502
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392422476|ref|YP_006459080.1|
Sequence length 529
Comment ferredoxin:oxidoreductase FAD/NAD(P)-binding subunit [Pseudomonas stutzeri CCUG 29243]
Sequence
MAAFNRFRLFHWLLAGFFLGAYLSGDDAETLHIWLGYGLVALLMWRLLIVPLRLRGFPQL
LPPKGQRSKPGLSSVGKWLTVGALGSFAIASVVGLGMVDNGDVLAALPGVGPDVFGAASD
IEFVGWMGDAEEVHEFFANLGLWLIGLHVGYVLLFRRKAVWPMLRGVPKSGPASTAPSTS
APVATSLALSPSPVEGEFTRLRIVSRQAETADSCSFTLQVPAAQRVRFTTQPGQFLTLKV
PGAEPALLRCYSLSQRPQADGALRITIKRVPGGRASNWLLDNLQAGDCIEALPPSGVFVP
RSLEGDLLLLGAGSGITPLMAILQAALVEGSGRVFLFYASRDAASLIFAEELAEWSARYP
ERLQLRIWLDAEQGVPNAAAIAAKLAGWPLAEAFVCGPQPFMDGASVALGELGVVAARIH
LERFGAAAPRGEAGRETGGRRSRLRVALDGRRHELDVPRGEVLLEAMEQAGLQPPSACRS
GVCAACKCRVVEGSVSMRSNQVLSESEVRQGWALACQAEPRSAELQVEY
Download sequence
Identical sequences I4CX50
gi|392422476|ref|YP_006459080.1| WP_014821480.1.18623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]