SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AFL2T_07572 from Aspergillus flavus NRRL3357

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AFL2T_07572
Domain Number 1 Region: 209-368
Classification Level Classification E-value
Superfamily E set domains 0.00000000077
Family Arrestin/Vps26-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AFL2T_07572
Sequence length 761
Comment | AFL2G_07572 | Aspergillus flavus hypothetical protein similar to arrestin domain protein (762 aa)
Sequence
MTTAHITPLQQDLSVTTTSPVVQLHCSPPESLSSGHTSPSAEHRQSVDPSAVVGANFPKQ
TNRRASIFRKLAGPRENAKRFLRLGGSVRAQSPPSIRSMSRTQRPRPVSEIVLSPEDARM
LASTSLGAGLGTGRMRSHSSSTGSVNQSSAGSVTSAPSSDSMGPFPTLRHEKIVATGSGI
TVGIALTEPVLYLQGYDHNDPSTKKFAILRGQLHLKVTKSVKIKKISICFRGHAQTDWPE
GIPPKKVHYHDKKDLVTHGMMYFNHGDSVLPQNDYGANFYQHAKPVASVTGKDGSPRNYR
MFPVGDYLYNFEFTIDGSLPETIKTDLGYVRYDLEAIVERSGAFRPNLLGNLEVPVIRTP
AEGSLEQVEPIAISRNWEDQLHYDIVISGKSFPLGSQVPIAFKLTPLAKVECHRIKVYVT
ENIQHWTADKSVHRFQPAKKVLLFEKRADSASTSTYPGSSMRVTAGGGIDWDHRAAAARG
DEIVDRNRTNLLGNLASDSGVGPTEMEFNVQLPSCHEMKNRDESHKLHFDTTYENIQINH
WIKIVLRLSKVDERDPTKRRHFEISIDSPFHLLSCKATQANIYLPAYTSPNSDPAPPAQE
YECGCPGAAALNRASSNGHSPCSEAEEPPTRAVNRSFTNGSGGLARPPQAHLAHEPSDRA
DEPPPRPMHLLRAPSFAPPAFEDVPPPPPLITPPPEYTSIVGNNDRETVLEDYFSRLSCY
EETADDPRGLGRVDVPLTPGGRVNRSMDVPREWVRLDQSTV
Download sequence
Identical sequences AFL2T_07572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]