SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478176788|ref|YP_007697861.1| from Octadecabacter arcticus 238

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478176788|ref|YP_007697861.1|
Domain Number 1 Region: 3-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.28e-111
Family FMN-linked oxidoreductases 0.00000000304
Further Details:      
 
Domain Number 2 Region: 333-513
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.24e-37
Family N-terminal domain of adrenodoxin reductase-like 0.0000157
Further Details:      
 
Domain Number 3 Region: 466-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000724
Family C-terminal domain of adrenodoxin reductase-like 0.0000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478176788|ref|YP_007697861.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase (NADPH) [Octadecabacter arcticus 238]
Sequence
MTSYPHLLAPLDLGFTTLKNRVLMGSMHTGLEETRDWNRVAEFYAERARGGVALMVTGGM
APNSEGGVFPGAAGLFSDQDIANHKVVTDHVHDAGGKIAMQILHAGRYAYSKDCVGPSAV
KSPISPFPPRELDEDGIEKQISDMVMAAKRAKEAGYDGVEVMGSEGYFLNQFLVTHTNKR
TDRWGGPYENRMRLPVEVVRRVREAVGTDFIVIYRLSMIDLIPDGSTWDEVVMLAKAVEA
AGATILNTGIGWHEARIPTISTSVPRRAFTWVTKKLMGEVSIPIITSNRINTPQVGEDVL
TDGCADMVSMARPFLADPHFVAKAKAGEAALITPCIACNQACLDHTFSMKIASCLVNPKA
CHETEIVLSPSSKSIGIVGTGPAGLASALAAAQRGMSVTLFDRADEIGGQLNMAKQIPGK
EEFWGLVDYYRAAVAEAGITVKLGQEVTAQDLAGFDEVIVATGVAPRDPQIEGQDGDNVL
SYIDVLRGKASVGKRVAIIGAGGIGFDVAEFLVTGDSTTENLDEWLVEWGVGDPSITRGG
VRAEGPQPDAAVRQVTVLQRKATKLGKNLGKTTGWIHRATLKMKGVEMIGGVNYERIDAD
GLHVSFGEARENPTLIAVDTIVMCAGQVPRRSLADALEAAGTKCHVIGGADVATELDAKR
AIDQGTRLVATL
Download sequence
Identical sequences M9RDZ0
gi|478176788|ref|YP_007697861.1| WP_015493643.1.8946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]