SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478180999|ref|YP_007702072.1| from Octadecabacter arcticus 238

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478180999|ref|YP_007702072.1|
Domain Number 1 Region: 3-341
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.08e-88
Family FMN-linked oxidoreductases 0.0000143
Further Details:      
 
Domain Number 2 Region: 314-510
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.59e-32
Family N-terminal domain of adrenodoxin reductase-like 0.00038
Further Details:      
 
Weak hits

Sequence:  gi|478180999|ref|YP_007702072.1|
Domain Number - Region: 493-621
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00423
Family C-terminal domain of adrenodoxin reductase-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478180999|ref|YP_007702072.1|
Sequence length 622
Comment oxidoreductase [Octadecabacter arcticus 238]
Sequence
MLKDNLPTKRMAAYHAARAKGGAGLIIIEAARAHVSGMSGRPAILAYDDACIPGYARIAR
DCQQHGAKVFAQLTHPGREMTTAMDGTQAVALAPSAVPNERFHVMPRAMTTQDITDIVAS
YSNASSRLKKAGLDGVEIVASHGVLAAQFLNPKVNLRTDTYGGSRENRMRFLCDILRAAR
SGAGRGMIVGVRLSIDEKDHDGLEPDEMITVATSLADQGLVDYLNVTAGTSAGLAGSTHI
VPPMAFETAYTAPLAAAIKAKVDVPVFVAGRINQPQIGEQIVASGQADMCGMTRALIADP
LMPNKAKAGHLDNIRACVACNQACVGHMLNGYPILCIQHPETGRELEFGTLKPATSPKNV
LVVGGGPGGLKAAAIAASRGHHVTLLEAQSTLGGQVRLAQMLPGRAEFGGVTDNLAREAT
HAGVDIRLNIRATRSTIEQHQPDAVILAVGAKPRTAALEGEGSGHIVQAWDVLQGRANVG
SNVVIADWRGDWIGLGLAERLARDGCHVRLAVNAITVGQAIPQYARDVWLGTLHKLGVGI
IPYMRLFGADAVSAYFQHTLSQEAVIMDGVDTVVTALGHDPETALADELSGHIKDLHLIG
DCLSPRSVEEAVLEGLQIAAQI
Download sequence
Identical sequences M9RS87
gi|478180999|ref|YP_007702072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]