SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MGG_00482T0 from Magnaporthe grisea 70-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MGG_00482T0
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Pre-PUA domain 8.5e-36
Family Nip7p homolog, N-terminal domain 0.0000708
Further Details:      
 
Domain Number 2 Region: 97-172
Classification Level Classification E-value
Superfamily PUA domain-like 9.94e-23
Family PUA domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MGG_00482T0
Sequence length 185
Comment | MGG_00482 | Magnaporthe grisea (M. oryzae) 70-15 60S ribosome subunit biogenesis protein NIP7 (186 aa)
Sequence
MRPLTDTETQTLLAKLANYTGNSLKSLIAPLEDGDRYVFRLHKDRVYYVKLSIANLATTI
ARDKLMSLGTCLGKFTKSGKFRLHITALPILSEHARYKMWVRSNGEMPFLYGGNVVKAHV
GRQTDDCPEHQGIVVYNMQDVPLGFGLTAKSTADARRLDPTGITCFRQSDCGEYLRDEDA
LFATG
Download sequence
Identical sequences G4NBT8 L7IGY6 L7JK47
XP_003718580.1.18062 148305.A4RF29 MGG_00482T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]