SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MGG_06911T0 from Magnaporthe grisea 70-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MGG_06911T0
Domain Number 1 Region: 7-186
Classification Level Classification E-value
Superfamily ITPase-like 7.85e-59
Family ITPase (Ham1) 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MGG_06911T0
Sequence length 189
Comment | MGG_06911 | Magnaporthe grisea (M. oryzae) 70-15 inosine triphosphate pyrophosphatase (190 aa)
Sequence
MTTSAPRKTVNFITGNQNKLAEVQAILEPTIEVQSQKLDLIEVQGTLEEVTLDKVRRAAE
QVEGPVLVEDTCLCFNALKGLPGPYIKWFMESIGHDGLNNLLAAYEDKSAQAVCTFGYSA
GPGSEPILFQGITEGKIVPPRGPPFFGWDAIFEYEGQTYAEMDKAEKNKISHRGKALEKL
QAWFAQREN
Download sequence
Identical sequences A4R1J6 L7IK31 L7JG98
MGG_06911T0 148305.A4R1J6 XP_003709645.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]