SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MGG_07225T0 from Magnaporthe grisea 70-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MGG_07225T0
Domain Number 1 Region: 87-129
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.00000000085
Family Ribosomal protein L36 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MGG_07225T0
Sequence length 130
Comment | MGG_07225 | Magnaporthe grisea (M. oryzae) 70-15 predicted protein (131 aa)
Sequence
MSGMAILGKAPRVGTSLLLSRCARATPAVGHKACLVQPQQTRSLWHRTPTTTTACNGSSR
INSLLSARPRVGAVQTALRQLQQARGMKLRSAITKRCEHCKVVRRKRGKRHRGYLYIICS
ANPRHKQRQS
Download sequence
Identical sequences G4MU35 Q5EMS7
XP_003715442.1.18062 148305.Q5EMS7 MGG_07225T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]