SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MGG_07571T0 from Magnaporthe grisea 70-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MGG_07571T0
Domain Number 1 Region: 51-99
Classification Level Classification E-value
Superfamily LysM domain 0.000000000144
Family LysM domain 0.0059
Further Details:      
 
Weak hits

Sequence:  MGG_07571T0
Domain Number - Region: 119-141
Classification Level Classification E-value
Superfamily LysM domain 0.0107
Family LysM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MGG_07571T0
Sequence length 142
Comment | MGG_07571 | Magnaporthe grisea (M. oryzae) 70-15 LysM domain-containing protein (143 aa)
Sequence
MQLTRFLSAWLLPAMAMAQTTTFQTSTTTATATAPATPSPTMPGLAPNCDGFHKLESGDN
CYEVAAKYGITMTQLYAWNTVVNDTCSNLLAGYYMCVHVPGAEAPTKPEPQMPGVVENCQ
KFYQIKAGDGCWSIYTEAGITY
Download sequence
Identical sequences G4N263
XP_003711486.1.18062 MGG_07571T0 148305.A4RA84

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]