SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000012 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000012
Domain Number 1 Region: 27-516
Classification Level Classification E-value
Superfamily ALDH-like 6.15e-144
Family ALDH-like 0.000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000012   Gene: ENSCPOG00000000015   Transcript: ENSCPOT00000000015
Sequence length 533
Comment pep:known_by_projection scaffold:cavPor3:scaffold_20:18244261:18266481:-1 gene:ENSCPOG00000000015 transcript:ENSCPOT00000000015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVTAAAVRARILQVSSKVNSVWYPASSFSSSVPTVKLFIDGKFVESKSDKWIDIHNP
ATNEVISRVPESTKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIARL
ITMEQGKTLADAEGDVFRGLQVVEHACSVTSLLLGETMPSITKDMDLYSYRLPLGVCAGI
APFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGKH
DAVNFICDHPDIKAISFVGSNQAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANKENTL
NQLVGAAFGAAGQRCMALSTAILVGEASKWLPELVERAKKLRVNAGDQPGADLGPLITPQ
AKERVCNLIGSGPKEGATILLDGRNIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGPV
LVVLETETLDEAIKIINDNPYGNGTAIFTTNGATARKYSHQVDVGQVGVNVPIPVPLPMF
SFTGSRASFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR
Download sequence
Identical sequences H0USZ7
ENSCPOP00000000012 10141.ENSCPOP00000000012 XP_003472461.1.53824 ENSCPOP00000000012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]