SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000040 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000040
Domain Number 1 Region: 148-219,266-535
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 5.69e-92
Family NadC C-terminal domain-like 0.0000201
Further Details:      
 
Domain Number 2 Region: 15-153
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.32e-35
Family NadC N-terminal domain-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000040   Gene: ENSCPOG00000000047   Transcript: ENSCPOT00000000047
Sequence length 538
Comment pep:known_by_projection scaffold:cavPor3:scaffold_95:2706193:2709392:-1 gene:ENSCPOG00000000047 transcript:ENSCPOT00000000047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEGNSEGRAAARPMLTDLYQATMALGYWCAGRACDPAEFELFFRHCPFGGAFALAAGL
RDCVRFLRTFRLQDEDVQFLASVLPADTDPEFFQHLRSLDCSAVTLRALPEGSLAFPGVP
LLQVSGPLLLVQLLETPLLCLVSYASLVATNAARLRLIAGPDKQLLELGLRRAQGPDGGL
TASTYSYLGGFNNSSNVLAGQLRGVPVAGTLAHSFITSFSGNEVPPNPMLTTAAGGSPKV
DLAASVKLWLEQVCACLGLGVQEPHSGERAAFVAYALAFPRAFQGLLDSYSVRRSGLPNF
LAVALALGELGYRPVGVRLDSGDLLQQAQEIRGIFRTVAAQFQVPWLESIPIAVSNNIDE
EQLARLAQEGSEVNIIGIGTSVVTCPQQPSLGCVYKLVSVGGQPRMKLTEDPEKQTLPGS
KAAFRLLASDGSLLMDLLQLAEEPPPQAGQELRVWLRGSQEPSIVRPAQVEPLLRLWLQE
GQLCEPLPSLTESRAFAQWSLSRLSPAHRQLKSPVQYQVALSEKLRRLADSLSSQNAP
Download sequence
Identical sequences H0UT23
XP_003463772.1.53824 ENSCPOP00000000040 10141.ENSCPOP00000000040 ENSCPOP00000000040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]