SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000095 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000095
Domain Number 1 Region: 413-702
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.94e-75
Family Protein kinases, catalytic subunit 0.000000292
Further Details:      
 
Domain Number 2 Region: 257-340
Classification Level Classification E-value
Superfamily Kringle-like 1.91e-33
Family Kringle modules 0.00036
Further Details:      
 
Domain Number 3 Region: 8-100
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-21
Family I set domains 0.033
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000095
Domain Number - Region: 116-203
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00366
Family Frizzled cysteine-rich domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000095   Gene: ENSCPOG00000000107   Transcript: ENSCPOT00000000108
Sequence length 883
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:68074209:68164177:-1 gene:ENSCPOG00000000107 transcript:ENSCPOT00000000108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSYLTLDEPMNNITTSLGQTAELHCRVSGNPPPSIRWFKNDAPVVQEPRRISFRATSYGS
RLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYR
GIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDECSQFAIPSLCHYAFPY
CDETSAAPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAA
HCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPE
LNGGHSYCRNPGNQKGAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAI
PLAIAFLFFFICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLSAYKPKSKAKELPLSAVR
FMEELGECSLGKIYKGHLYLPGMDHAQLVAIKTLKDCNSPQQWTEFQQEASLLAELHHPN
VVCLLGAVTQEQPVCLLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLH
IAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLL
PIRWMPPEAILYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKGQLLPCS
EDCPPRMYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLS
ASPVSNLSNPRFPNYMFPGQGIPQGQIAGFIGPPIPQSQRFIPINGYPIPPGYAAFPAAH
YQPAGPPRVIPHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSLPSHPA
GGMGITVFGNKAQKPYKIDSKQPSLLGDANIHGHSESMVSAEL
Download sequence
Identical sequences ENSCPOP00000000095 10141.ENSCPOP00000000095 ENSCPOP00000000095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]