SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000149 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000149
Domain Number 1 Region: 89-201
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 2.75e-26
Family Ribosome-binding factor A, RbfA 0.00000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000149   Gene: ENSCPOG00000000170   Transcript: ENSCPOT00000000171
Sequence length 345
Comment pep:known_by_projection scaffold:cavPor3:scaffold_105:783903:805365:-1 gene:ENSCPOG00000000170 transcript:ENSCPOT00000000171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAAARGLWASGAGPRVLWGNGDGASLLGPLRGLRSSAASCGSKNLLKKFASKTRKKFWY
AGPSLGSHLTYKPSKLESLLKATSKKSRKEDHVRLRALNGLLYKALTDLLSTPEVSQEVY
DLNVELSKVSLTSDFSACRVYWKTSLSADQNKHTEAVLQRSAGYMRHLLMAQQTLRNVPP
IVFVQDRRNALLAEVDQLLAVADFGPMDETDNLAQARDPDALSPHDPPGPAAHGYLCGID
HNALNKQIMEYKRKKEKGLQDTRVVSPGQVQMAKVPQWVRRRRKALSQADQDTSPRSFLL
GEDSEDKDEDSILECGCQSQNTEEWEAEPGGRGTQQDPHGRTEQG
Download sequence
Identical sequences 10141.ENSCPOP00000000149 ENSCPOP00000000149 ENSCPOP00000000149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]