SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000155 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000155
Domain Number 1 Region: 359-766
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-89
Family ALDH-like 0.0000000982
Further Details:      
 
Domain Number 2 Region: 71-350
Classification Level Classification E-value
Superfamily Carbamate kinase-like 1.57e-48
Family PyrH-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000155   Gene: ENSCPOG00000000179   Transcript: ENSCPOT00000000180
Sequence length 791
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:29419928:29459884:-1 gene:ENSCPOG00000000179 transcript:ENSCPOT00000000180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQVYRSGFQPFNQRLLPWVQSTAASRLYCGQHSAMRHVRSWSNIPFITVPLSRAQGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPAEPNSDLQGVNV
ISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTK
SRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGKVKPAGPTVE
QQGEMARSGGRMLATLEPEQRAEIIYHLADLLTDQQEEILLANKKDLEEAEGRLAGPLLK
RLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRP
DCLPQVAALAIATGNGLLLKGGKEAANSNRILHLLTQEALAIHGVKEAVQLVNTREEVED
LCRLDKMIDLIIPRGSSQLVRNIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDS
KCEYPAACNALETLLIHRDLLRTSLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKSL
RIEYGDLELCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVFWNAS
TRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSLKYLH
ENLPVPQRNTN
Download sequence
Identical sequences 10141.ENSCPOP00000000155 ENSCPOP00000000155 ENSCPOP00000000155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]