SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000236 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000236
Domain Number 1 Region: 35-160
Classification Level Classification E-value
Superfamily Lysozyme-like 5.9e-47
Family C-type lysozyme 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000236   Gene: ENSCPOG00000000268   Transcript: ENSCPOT00000000271
Sequence length 161
Comment pep:novel scaffold:cavPor3:scaffold_39:16999347:17010174:-1 gene:ENSCPOG00000000268 transcript:ENSCPOT00000000271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLIFDRSCVGTGVRMKATGVLLLIGLLVTDIESRVYTRCKLAKIFSRAGLDNYAGFVLG
NWICMAYYESRYNTSAQTVLDDGSTDYGIFQINSFTWCRDSSFQKNHCHVACSALLSDDL
TDAIICAKKIVKETQGMNYWQGWKKHCEGQDLSEWKKGCDV
Download sequence
Identical sequences 10141.ENSCPOP00000000236 ENSCPOP00000000236 ENSCPOP00000000236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]