SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000424 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000424
Domain Number 1 Region: 113-225
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-29
Family C-type lectin domain 0.0000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000424   Gene: ENSCPOG00000000481   Transcript: ENSCPOT00000000486
Sequence length 226
Comment pep:novel scaffold:cavPor3:scaffold_86:3056599:3065194:1 gene:ENSCPOG00000000481 transcript:ENSCPOT00000000486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLLLLALLLGAVSTRHLKVDTSSLQSLRGEESLAQDGETAEGATREATAGALMPLPEE
EEMEGASGSEDDEAIPTMRNEAKALQDQEDSLCPREEDTVLIQGGPRCPIHHYLLVRTPK
VFNQAKNICKRCYGGNLVSIHNYRANHHILLHASKINQAQVWIGGFLKGWFLWKKFRWTD
GSSWNFGYWAPGQPGNGKGSCVALCTKGGHWRCARCYNRLPFICSY
Download sequence
Identical sequences ENSCPOP00000000424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]