SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000434 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000434
Domain Number 1 Region: 1040-1085
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000353
Family Nuclear receptor coactivator interlocking domain 0.00052
Further Details:      
 
Domain Number 2 Region: 123-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000223
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 268-372
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000297
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00055
Further Details:      
 
Domain Number 4 Region: 32-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000432
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000434   Gene: ENSCPOG00000000493   Transcript: ENSCPOT00000000498
Sequence length 1435
Comment pep:known_by_projection scaffold:cavPor3:scaffold_0:42444965:42525623:1 gene:ENSCPOG00000000493 transcript:ENSCPOT00000000498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMGENTSDPARAETRKRKECSDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSI
VNGGSWSGEPPRRNSHTFNCRMLVKPLPESEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHMLHREQNPCMNPDLTGQAMGKPLNPISSSSPAHQAMCSGNPGQDMTLSS
NINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPGQ
PNSMLSPRHRMSPGVAGSPRIPPSQCSTGNSHSYTNSSLNALQALSEGHGVSLGSSLASP
DLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQAESSCHPGEQKETNDS
SISQAASGERAEGQNRLHDSKGQTKLLQLLTTKSDQMEPSPLPNSLSDTNKDSTGSLPSS
GSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELSQESSTTAPGSEVTIKQEPV
SPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTKLIAMKTEKEEMSFEP
SDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAIINDLMQLTAENSPVTP
VGAQKTALRISQSTFNNPRPGHLGRLLPNQNLPLDITLQSPTGAGPFPPIRNNSPYSVIP
QRNLGNSSTGMMGSNASRPTMPSGEWASQSSAVRVTCAATTSAINRPIQGGMIRNPTTSI
PMRPSSQPGQRQMLQSQVMNLGPSELEMNMGAPQYSQQQAPPNQTAPWPESILPIDQTSF
ASQNRQPFGSSDDLLCPHPAAESPSDEGALLDQLYLALRNFDGLEEIDRALGIPELVSQS
QAVDPEQFSSQDSNIMLEQKAPVFPQQYASQAQIAQGSYTPMQDPNFHTMGQRPSYATLR
MQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQQNRQPLMNQISNVSNVNLTLRPGVPTQAP
INAQMLAQRQREILNQHLRQRQMHQQQQVQQRTLMMRGQGLNMTPSMVAPSGIPATMSNP
RIPQANAQQFPFPPNYGISQQPDPGFTGATTPQSPLMSPRMAHTQSPMMQQSQANPAYQA
PSDMNGWAQGNMGGNSMFSQQSPPHFGQQANTSMYNNNMNISVSMATNTGGMSSMNQMTG
QISMTSVTSVPTSGLSSMGPEQVNDPALRGGSLFPNQLPGMDMIKQEGDASRHTC
Download sequence
Identical sequences ENSCPOP00000000434 10141.ENSCPOP00000000434 ENSCPOP00000000434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]