SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000607 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000607
Domain Number 1 Region: 220-300
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000886
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0056
Further Details:      
 
Domain Number 2 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000655
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000607
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0048
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000607   Gene: ENSCPOG00000000685   Transcript: ENSCPOT00000000690
Sequence length 802
Comment pep:known_by_projection scaffold:cavPor3:scaffold_42:7030880:7035544:1 gene:ENSCPOG00000000685 transcript:ENSCPOT00000000690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTLPSALDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGTGPGPGPGPASLFLAMFQSRHAKDLALLDVSESVLIYL
GFERSELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEMVVRLQSKHGGWAWIYCLL
YSEGPEGPITTNNYPISDMEAWSLRQQLNSEDTQAAYVLGNPTVLPSFPENVLSQEQCSN
PLFTPPLGAPRSTSFPSAPQLGVVSTSEELPRSLQKLDFSYLPFPSGPEPSLQADLSKDF
VCTPPYTPHKPGGCAFLFSLHEPFQTHLPPPSSSFQEQLTPSTSTFSDQLTPSSATFPDP
LISPLQGQLTEISTRNYEDQPTPCTSTFSDQLLPSTATFPEPLGSPTHERLTPPTAAFQA
PLNSPSQTFPEQLSPNSTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSV
DVPLVPEGLLTPEASPVKQSFFHYSEKEQHEIDRLIQQISQLAQGMDRPFSAEAGTGGLE
PLGGLEPLDSNLSLSGAGPPVLSLDLKPWKCQELDFLADPDSIFLEEMPVEDIFMDLSTP
DPNGEWDSGDSEAEGPRRAPSPCNNLSPEDHSFLEDLATYETAFETSVSTFPYDGFTDEL
HQLQSQVQDSFHEDGSGGEPTF
Download sequence
Identical sequences H0UUG6
XP_003468315.1.53824 10141.ENSCPOP00000000607 ENSCPOP00000000607 ENSCPOP00000000607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]