SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000656 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000000656
Domain Number - Region: 50-96
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0575
Family 2-methylcitrate dehydratase PrpD 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000656   Gene: ENSCPOG00000000737   Transcript: ENSCPOT00000000742
Sequence length 257
Comment pep:known_by_projection scaffold:cavPor3:scaffold_67:9538425:9540539:1 gene:ENSCPOG00000000737 transcript:ENSCPOT00000000742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSKIGSRRWLLQLLMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMG
AAVLCASFMSFGVKRRWFALGAALQLAVSTYIAYVGGHVHYGDWLKVRMYSRTVAIIGGF
LVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMV
QLFFLLYGVLALAFLSGYYVTLAAQILAVLLPPVMLLIDGNIAYWHHTRRVEFWNQMKLL
GENVGIFGAAVILATDG
Download sequence
Identical sequences A0A286XTU2
ENSCPOP00000000656 10141.ENSCPOP00000000656 XP_003465795.1.53824 ENSCPOP00000000656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]