SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000829 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000829
Domain Number 1 Region: 168-427
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.14e-79
Family Eukaryotic proteases 0.0000000212
Further Details:      
 
Domain Number 2 Region: 50-158
Classification Level Classification E-value
Superfamily Kringle-like 1.67e-30
Family Kringle modules 0.0000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000829   Gene: ENSCPOG00000000920   Transcript: ENSCPOT00000000926
Sequence length 434
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:22634644:22639204:1 gene:ENSCPOG00000000920 transcript:ENSCPOT00000000926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVLLASLLFCALVVSDSEGYREIEASGAENCGCLNGGTCVSYKYFSSMQRCSCPKKFQG
EHCEIDASKTCYDGNGHSYRGKANTDTRGRPCLAWNSDSVRSQKFHTHRSDAVQLGLGKH
NYCRNPDNHRWPWCYVQIGLTQSIQKCKVSSCSLENRPSPPREEQEFQCGQKATPNPRFK
IVGGYFTTIENQPWFAAIYKRNRGGSVSFVCGGSLIKPCWVVSATHCFINHQVKENYIVY
LGRSRRSSTTPGEMEFEVEQLILHKNYSAETLAHHNDIALLKIRSSGGQCAQPSPSIQTI
CLPPKDSEPSFGTSCEVTGFGQESANDYLYSERLKMTSVKLISYQLCQQPLYYGSEVTTQ
MLCAADSDKWETDSCQGDSGGPLVCITQNRLTLTGIVSWGRGCALKYKPGVYTKVSSFLP
WIYTHIREDNSLNL
Download sequence
Identical sequences H0UV14
XP_013012439.1.53824 ENSCPOP00000000829 ENSCPOP00000000829 10141.ENSCPOP00000000829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]