SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000961 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000961
Domain Number 1 Region: 136-266,309-459,525-548
Classification Level Classification E-value
Superfamily TROVE domain-like 2.35e-57
Family TROVE domain-like 0.0071
Further Details:      
 
Domain Number 2 Region: 1931-2275
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.94e-50
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 1554-1843
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.74e-48
Family WD40-repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 1026-1269
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000011
Family Nitrogenase iron protein-like 0.077
Further Details:      
 
Domain Number 5 Region: 2162-2228,2345-2496
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000518
Family Quinoprotein alcohol dehydrogenase-like 0.048
Further Details:      
 
Domain Number 6 Region: 1807-1918
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000314
Family SGL-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000961   Gene: ENSCPOG00000001064   Transcript: ENSCPOT00000001075
Sequence length 2497
Comment pep:novel scaffold:cavPor3:scaffold_13:21656294:21701888:1 gene:ENSCPOG00000001064 transcript:ENSCPOT00000001075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STFPGIKSSVSASSLLQRLQLSHRPHADLCSLHTSTCLPSEAPSSRTAQCLSAVETESVP
RGVRGAPVSQAVTLDRLCCSKEEEKSEGKEEEGAQMPVYSLSLGEEEESEELAPQLTSEA
LESHSEPTDQNLQENKMILMSLLCSTVASNVSTDDAILCICKKLAPLEPEFILKASLYAR
QQLNLRDVANKVLAIAALLPPCRPHLRRYFCAIVHLPSDWIQVAEFYQQELAKGEDSKLV
PLPACLRAAMTDKFAQFDEYQLAKYNLRKHRAKSRPRRPPRPPEPRPSKRIIFPRYLCPI
RKVQVKFEAEKKNQSQFTLKKLVQRLHIHEPAQHVQALLGYRYPSSLQLFSRSRLPGPWD
SSRAGKRMKLPRPETWDRALSLQGNKASVWEELIDSGKLPFMAMLRNLRNLLRVGISAAH
HELILQRLQHAESVIHSRQLPFRFLNAHDAINDLETQLSNQALPFPSNTKLLRQIMIRNS
KCYKKYPRYLCTLSRRKLRTAMMIPGIYAQLKREKLRVHKARQCNFDTELLARYRQALEA
AVSLSVKHNLPPLPGRTHLVYLTDAGADHFCAKSNAQGAPLNYVLLLLGMMVARAEQAEV
ALCGSGMLKIAELAAGEGILQTALRLQAQVQELEEGEEQPLVTFKKYLLSLAVQRVPMDR
VVLFGHAMCQEMLLVAPHLIWQHVNPKCLFVSVLLRKTVGFTSSNPNEVTLSGCTDGILK
FIAERGASRLLEHVGQMDRIFKIPPPLGKTQVPTLRPLEEDAPSRLAPLSQPGWRSIRLF
ISSTFRDMHGERDLLLRSVLPALQARAASHRISLHGIDLRWGITEEETRKNRQLEVCLGE
VENSQLFVGILGSRYGYVPPNYSLPDHPHFRWAQQYPPGRSMTEMEVMQFLNRDQGLQPS
AQALIYLRDSSFLSSVPENWRADFAAESEEATQRMSELKSYLSRQKRVTCRRYSCEWGGV
AAGRPYTGGLEEFGQLVLQDVWSMIQKLYLQPGAELQQPASISEDDVVQATFQELWSPSS
PARPKLLRDTVRQLMLPRGTLSLVTGQSGQGKTTFLASLVSALQAPDGVKVAPTVFFHFS
GARPDQALALNLLRRLCTHLHGKLHKASALPSSYRRLVWELQHKLLPECAETLQPGQTLV
LIIDGADKLVNENGQLMSDWIPKSLPRWVHLVLSVSSNSGLGETLEQSQAAHVVTLGPLE
PSVRAQLVREELALYGKRLEESPFNNQMQLLLVKWASGLPLYLRLVTDHLRLFTLYEQVS
ERLRSLPATVPLLLEHILSTLEHEHGRDVLPQTLASLEVTRSGLTVEQLHAVLSAWQILP
KGTKSWEEAVAAGNSGEPYPMGPFAYLVQSLRSLLGEGPLERPGARLCLPDGPLKTAAKR
RYGKRRGLEDTAHVLIAALLWKACDPDASGFFRRCPPEALGDLPYHLLLSGHRALLAKFL
TSLHVVAAHLDLGLLPRLLEAHALYASSGPEEEPKLPEADVAAFRTFLRQQAPVLSRYPR
LLRQQAANQPADSPVCCQAPLLSQRGHLQRMLRWLNKPQSVRGQHSSSTSLAISSSPTAV
AISLNGQRAAVGTANGTVYLLNLRTWQEEKSVVSGCDGISSCTFVSDNALFLSAFDGLLE
LWDLQCGCRDRVLQTQAHQYQITDCCLSPDRRLLATVCLGGCLKLWDTVRGQLSFQHTGA
KPLNCLAFHPEGQALATGSWAGSISFFQVEGLKATKELGAPGSSVRTLAFNAPGRVVAVG
RLDRMVELWAWQEGARLATFPAHCGFVSAVLFLHAQNQLLTAGEDGKVQVWSGSLGRPRG
CLGSLPLSPALSVALSLDSKRVAVGYRTDGIKIYRVPSGSQLVQGPMLEVAVSALAWLSP
QVLVSGTEDGTLQGWLLKESTLQSLWLLPQNQKAVLGLASCQHLLASASEDCTVRLWPKQ
LLTQQHKTGDLPCAAELRGHEGPVSCCSFSVDGGSLATGGRDQSLLCWDVRTPQTPLLMR
SFPACHRDWVTGCAWTKDNLLISCSSDGSVGLWDPKSGQQLGHFLGHQSAVSTVVAVAEH
VVSVDRDGTLKVWARGGVELTSIPAHSGPISQCAAALEPRPARQSGSELLVVTVGLDGAT
RLWHPLMVWQTHILPGHGGPVSAAAICQSSGLLLTASEEGSVRLCQVPEKADDTSTPRSF
AAITAVAWAPDGSVAVSGNQAGELTLWQEAKAVATAQAPGRVSALLWFSADTFFVLSDDE
KISKWRVHGLERQTASTSRRLSYSLHLNQVLQEVGILTSLELAPNGLSLILVSADLEILQ
LTPGNAPRVIADKLGIHPILLSTHKEHGVFFLHTRHPGCLSFLKQKETGEFEERLEFYID
LENPSGSSVLTQAKPESECSFLCASSDGVLWTLAGCSPEGGWTTGNMWQTKEPEDQASGT
DASDASMANWPRMGLKMQQCRKIHSDSVTALHVLPELLVTGSKDRDVKLWARPSMQLLGL
FRCEGAVSCLQPWQGPDSTLRLAVGDTQGNVYFLSWE
Download sequence
Identical sequences ENSCPOP00000000961 10141.ENSCPOP00000000961 ENSCPOP00000000961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]