SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001011 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001011
Domain Number 1 Region: 260-365
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.33e-20
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00000173
Further Details:      
 
Domain Number 2 Region: 921-967
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000235
Family Nuclear receptor coactivator interlocking domain 0.0001
Further Details:      
 
Domain Number 3 Region: 120-184
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000314
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 4 Region: 14-87
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001011   Gene: ENSCPOG00000001117   Transcript: ENSCPOT00000001129
Sequence length 1442
Comment pep:known_by_projection scaffold:cavPor3:scaffold_18:6730103:6826899:1 gene:ENSCPOG00000001117 transcript:ENSCPOT00000001129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSMSRVNPSVNPSISPAHGVARPPTLPPSNSNMVSARVNR
QQSSDLHSSSSHTNAGNNQGSFGCSPGNQIVANVALNQGQASSQSSNPSLNLNNSAMEGT
GISLTQFMSPRRQVTSGLAARGRVPNNSFPPNIPTLNSPVGMTSGACSNSNRSYSNIPVP
SLQGMNEGPSNSVGFSASSPVLRQMGSQNSPSRLSLQPAKTESKDNKEIASILNEMIQSD
NSSSDGKPLDSGLLHSNDRLSDGDSKYAQTSHKLVQLLTTTAEQQLRHADIDASCKDVLS
CTGASNSASANSSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDTAAASV
SAAGQAQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKE
QMDPCTTNSTPVSKPAPEEIKLESQSQFAADLDQFDQLLPPLEKAAQLPGLCETDRMEGA
ATSVTIKSESLPASLQPTTARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWANNAVTAV
NQTKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDK
LVQGGGLDVLSERFPPQQATPPLMMEERPSLYPQPYNSPSPTASLPSPFQGMVRQKPSLG
TMPVQVTPPRGTFSPGIGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQ
FAANAPVGMTMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQS
FGNNLPPSSGLPVQMGSPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEAPLA
TRSSMVSRGMAGTMGGQFGTGISPQMQQNVFQYPGSGMVPQSEANFAPSLSPGSSMVPMP
IPPPQSSLLQQTPPTSGYQSPDMKAWQQGAMASNNVFSQAVQNQPTPAPPGVYNNMSITV
SMAGGSTDVQNMNPMMGQMQMGSLQMPGMNAVCPEQINDPALRHTGLYCNQLSSTDLLKT
EADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGSQKPTPGPQTPQVQQKSLLQQLL
TE
Download sequence
Identical sequences A0A286XEK0
ENSCPOP00000001011 10141.ENSCPOP00000001011 ENSCPOP00000001011 XP_013011361.1.53824 XP_013011362.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]