SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001065 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001065
Domain Number 1 Region: 463-793
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.9e-106
Family PDEase 0.00000128
Further Details:      
 
Domain Number 2 Region: 195-296
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-17
Family Flavin-binding PAS domain 0.052
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000001065
Domain Number - Region: 69-142
Classification Level Classification E-value
Superfamily CheY-like 0.00338
Family CheY-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001065   Gene: ENSCPOG00000001181   Transcript: ENSCPOT00000001193
Sequence length 805
Comment pep:known_by_projection scaffold:cavPor3:scaffold_83:213778:435325:1 gene:ENSCPOG00000001181 transcript:ENSCPOT00000001193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSQGGSLATCRGRRSHCCASAEAETQTSYASVQQVSSAEVRIGPMRLIQDPIQVLLIFAK
EDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQTRNFNAEAVCRSIR
ATNPSEHTVILAVVSPASEDHEEASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVR
SQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELAELPKS
DKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKITPVIGQGGKIRHFVSLKKL
CCTTDHNKQMHKIHRDSGDSSQTELHSIRHKNRRKESIDVKSISSRSSDAPSLQNRRYPS
MARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSPQLGAKDEDPH
TSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHGHLSMPVTINDVPPCITQLLDNEESWDFN
IFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCSEATLRAWLQVMEANYHSSNAYHNSTHA
ADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYND
TAVLESHHTALAFQLTVKDAKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFV
NSVNKPMAAEMEGADCECGPAGKGFPENQILIKRMMIKCADVANPCRPLDLCIEWAGRIS
EEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFAHLPALMQH
LADNYKHWKTLDDLKCKSLRLPSDS
Download sequence
Identical sequences ENSCPOP00000001065 10141.ENSCPOP00000001065 ENSCPOP00000001065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]