SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001079 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001079
Domain Number 1 Region: 35-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.15e-48
Family Ribosomal protein S7 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001079   Gene: ENSCPOG00000001195   Transcript: ENSCPOT00000001207
Sequence length 242
Comment pep:known_by_projection scaffold:cavPor3:scaffold_317:96636:99588:1 gene:ENSCPOG00000001195 transcript:ENSCPOT00000001207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASALKVVRSWSGLAPGVTFAVWSIPRQTQVRWSRYSPEFRDPLTDKEHYRKPVAGLTE
EEKYEKELKKTQLIKAAPTTTTCSVFADPVISKFTNMMMKGGNKILARSLITQTLEAVKR
KQFEKHRTASAEEQAIIERNPYIIFHQALKNCEPVIGLVPILRGGHFYQVPVPLADQRRR
FLAMKWMITECREHKHRRILMPEKLSHELLQAFHNQGPVIKRKQEMHKMAEANRALAHYR
WW
Download sequence
Identical sequences H0UVN6
XP_003461036.1.53824 10141.ENSCPOP00000001079 ENSCPOP00000001079 ENSCPOP00000001079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]