SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001158 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001158
Domain Number 1 Region: 400-421,449-490,665-795
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.94e-24
Family Phosphate binding protein-like 0.00000151
Further Details:      
 
Domain Number 2 Region: 76-388
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000118
Family L-arabinose binding protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001158   Gene: ENSCPOG00000001279   Transcript: ENSCPOT00000001295
Sequence length 1232
Comment pep:known_by_projection scaffold:cavPor3:scaffold_76:332221:343571:1 gene:ENSCPOG00000001279 transcript:ENSCPOT00000001295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPVLVFPQELPADMGGTLGPALLFTSLLGAWAGPGEQAVTVAVVFGSSGSPQAQARAHFT
PQSFLDLPLEIQPLTVGVNSTNPSSLLTQICGLLGAARVHGIVFEDNVGTEAVAQLLDFV
SSQTHVPILSISGGSAVVLTPKQWEADAAFQVLAVSWGENILTTSPAAVPNWKVYSVITS
LHPGHALFLEGVRAVADASYLSWRLLDVLILETQRLLRQLDAPVLVAYCSREEAEVLFAE
AAQAGLVGPGHVWLVPSLALGSTDTPPAVFPALISVVTESWRLSLRQKVRDGVAILALGA
HGYQRQYGALPAPAGDCHSHPGPISPAREAFYRHLLNVTWEGRDFSFSPGGYLVQPTMVV
IALNRHRLWEMVGRWDHGVLYMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRKSNQTFRFSSSDTASYTRLCCRGFCIDILKKLPKVVKFSYDLYLV
TKRKLAKQFRGVGRHDRGEGFQGKEQVPLPRMIFTAQEQVPVAVRISPPGDETWGLSFYA
SRIRIPLSPEPYSPAVWVMMFVMCLTVVAVTVFMFEYFSPVSYNQTLTKGKKPGGPSFTI
GKSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDT
VSGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALASLK
MGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQ
FLGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLV
YWKLRHSVPSTSQLDFLLAFSRGIYSCFGGVQSLASPPRQPSPDLTTGSAQASVLKMLQA
ARDMVTTVGVSDSLDRATRTIESWGMGSSRRAPPPACAGPAPPPPTPVPPPQPSPRSWGS
PSRGRATLIRRAPQPPGHCPTPGTQLPDVSRVCARPLWETQWGAGHTEQHLWASEWRALS
PAHCHYSSFPRDRSRRTFLPLFPEPPEPDDLPLLGPEQLAQREALLRAAWAHGPRPRHAS
LPSSVAEAFTRPGSLTFGCTGHACACPDARPACRRLAQAQSMRLLSQREACWEGVPAGAP
VWQPRQHICLHTHAHLPLCWGAVCPHLPPCASQQPWLAEAWAPPAHRGRTTGLSAGYRAS
EALEELGRGACGTQDFLGPCTWRRISSLESEV
Download sequence
Identical sequences ENSCPOP00000001158 ENSCPOP00000001158 10141.ENSCPOP00000001158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]