SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001460 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001460
Domain Number 1 Region: 519-703
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-45
Family cAMP-binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 249-424,454-515
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.61e-44
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Domain Number 3 Region: 36-129
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.92e-19
Family Flavin-binding PAS domain 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001460   Gene: ENSCPOG00000001618   Transcript: ENSCPOT00000001639
Sequence length 742
Comment pep:known_by_projection scaffold:cavPor3:scaffold_65:4610890:4673812:1 gene:ENSCPOG00000001618 transcript:ENSCPOT00000001639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVHRGHVAPQNTDTIIHKFEGLSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVMQR
PCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDGTV
IMFILNFEDLAQLLAKNSSRSLTQRLLSRSFLGSEGSHGRPGGQGPGPGRGKYRTVSQIP
QFTLNFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQAP
RIHRGTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESQRGACGYTCSPLTM
VDLIVDIMFVVDIVINFRTTYVNSNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLIFR
TGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAI
GNVERPYLEPKIGWLDSLGAQLGKHYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFGNV
SPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIP
NPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQQCPAFQGASKGC
LRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEPVS
LHAQPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFADSFWSKLEVTFNLRDADGGLQ
SSPQQAPNKDHHGFFLSDNQSG
Download sequence
Identical sequences ENSCPOP00000001460 ENSCPOP00000001460 10141.ENSCPOP00000001460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]