SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000001596 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000001596
Domain Number 1 Region: 622-1149
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.24e-153
Family alpha-mannosidase, C-terminal domain 0.0000015
Further Details:      
 
Domain Number 2 Region: 124-499
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.59e-136
Family alpha-mannosidase 0.00000000115
Further Details:      
 
Domain Number 3 Region: 502-616
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 7.52e-29
Family alpha-mannosidase, domain 2 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000001596   Gene: ENSCPOG00000001765   Transcript: ENSCPOT00000001786
Sequence length 1150
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:33861413:33879335:1 gene:ENSCPOG00000001765 transcript:ENSCPOT00000001786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPARHQSGGNFPRSQISVLQNRIEQLEQL
LEENHEIISHIKDSVLELTANADSLPALLPYHTANGSWVVPPEPRPSFFSVSPQDCQFAL
GGRGQKPELLMLTVSEELPFDNVEGGVWRQGFDISYSPHDWDAEDLQVFVVPHSHNDPGW
IKTFDKYYTEQTQHILNSMVIKLQEDSRWRFLWAEVSFFAKWWDNISAQKKAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGVTPRSGWAVDPFGHSSTMPYL
LRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTC
GPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSRLFRSNVLL
VPLGDDFRYDKPQEWDAQFFSYQRIFDFLNSKPDLHVQAQFGTLSDYFDALYKRTGVEPG
ARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEVHLRGAEMLYSLAVAHAR
HSGLAARYPLSDFTLLTEARRTLGLFQHHDAITGTAKEVVVMDYGVRLLRSLVSLKQVII
NAAHYLVLRDKGTYHFEPGTPFLQVDDTRSSHDALPERTVIQLDASPRFVVIFNPLEQER
LSVVSLLVSSPLVRVLSEDGQPLAVQISAHWSSATTMVPNVYQVSVPLRLPALGLSVLQV
QQGLDTHRTLSSSVRIYLHGQRLSVSRHEAFPIRLIDSGGSDFVLSNRYMQVWFSGLTGL
LKSVQRMDEDQEQRIDMELLVYGTRASKDKSGAYLFLPDDQAKPYVPKNPPVLRVTEGPF
FSEVVACYEHVHQVVRLYNLEGVEGLSLDVSFLVDIRDYVNKELALRIHTDIDSQGTFFT
DLNGFQVQRRRYLKKLPLQANFYPMPVMAYIQDAQRRLTLHTAQALGVSSLSKGQLEVIL
DRRLMQDDNRGLGQGLKDNKRTWNRFRLLLERRTTGSEAQDSHSTSYPSLLSHLTSMHLN
APVFTLPVAKTLFPGPSLQTFHPLASSLPCDFHLLNLRTLQAEEDNLLSADAALILHRKG
FDCGLEAKNLGFNCTTSQGKVALGSLFHGLDVVFLQPTSLTLLYPLASPSNSTDLYLEPM
EIATFRLRLG
Download sequence
Identical sequences 10141.ENSCPOP00000001596 ENSCPOP00000001596 XP_003475809.2.53824 ENSCPOP00000001596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]